> The sequence is generated based on the alignment of the input domain models and the input sequence
NRHIILIGFMGVGKSTISHELSRLASRIEIDTDQWIEEKEGRAISDIFAKEGETYFRDLETSMIDELGMIKPAIISCGGGMALRELNVRKLQAIGTVVLLTAKPEIRQMMEKRRVYYEHAATVTVSTDGKIITEIAKEILEKCFKAKECGCYAGKLACMPKTREDVDTLLNATAAMKEEFPDFPLITMSMGELGKVSRLYGGLYGSFVSFGCVSEASAPGQVYYETMCEVFDKIYKG
T1180_D1_AB_BC_target_SADA
multipart/form-data; boundary=939c067bba054a81823e31b123eb1385
trRosetta server
The job has been submitted successfully. The job id assigned is TR123067.
You can track the job status and the modeling results at:
http://yanglab.nankai.edu.cn/trRosetta/output/TR123067/
A notification email will be sent to 610222661@qq.com after the modeling is completed.
(Please note that due to the restrict of Google usage in the mainland of China, our system may fail to send an email notification to gmail and gmail-related accounts.
In such case, please bookmark the results page to access the modeling results later.)