[back to server]

RocketX Results for job R102630

[Click on R102630.tar.gz to download the tarball file including all results listed on this page]


   Input Sequence

>query_sequence (281 residus)

GDITHMASMTGGQQMGRDPMRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQ


   Predicted Structure Models












Model 1 (Download)












Model 2 (Download)












Model 3 (Download)












Model 4 (Download)












Model 5 (Download)
















   Predicted Inter-residue Geometries

Distance
Omega
Theta
Phi

   Evluation of Model 1

Inter-residue Distance Deviation
Per-residue lDDT score


References

  • Jun Liu, Guang-Xing He, Kai-Long Zhao and Gui-Jun Zhang*. De novo protein structure prediction by incremental inter-residue geometries prediction and model quality assessment using deep learning. bioRxiv, doi: 10.1101/2022.01.11.475831.